LL-37
Immune In trials Human trials
Also called Cathelicidin, CAP-18 fragment
The only cathelicidin antimicrobial peptide humans make. White blood cells and skin release it to kill bacteria directly by disrupting their membranes. It also directs immune cells and supports wound closure. Too much of it is tied to conditions such as rosacea and psoriasis.
Why people take it
What studies report
- Direct killing of bacteria, including some resistant strains, in lab tests
- Improved healing of hard-to-heal venous leg ulcers in a phase 2 topical trial
In practice Unapproved use
- A niche choice in the chronic infection and biofilm community
Reported real-world use, not evidence and not a recommendation.
Worth knowing: Too much LL-37 drives rosacea and psoriasis flares, so more is not better.
Status: Small trials for hard-to-heal leg ulcers. Not approved.
- Route
- Subcutaneous injection, from reconstituted lyophilised powder
- Sequence
- LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
- Formula
- C205H340N60O53
- Molecular weight
- 4493.3 g/mol
- CAS
- 154947-66-7
- Available as
- 4 mg
Educational information only. Nothing here is medical advice, a dosing protocol, or a recommendation to use any compound. Most entries describe substances not approved for human use. Talk to a licensed clinician before acting on anything you read here. How to read these entries.