VIP
Immune Approved · Some countries Human trials
Also called Vasoactive intestinal peptide, Aviptadil (synthetic form)
A 28-amino-acid signaling peptide made in the gut, pancreas and brain. It relaxes smooth muscle, widens blood vessels and airways, drives fluid secretion in the intestine, calms inflammation and helps set the body clock. Its half-life in blood is only about a minute.
Why people take it
What studies report
- Relaxes airways and blood vessels, reduces inflammation
- Trialed as aviptadil for respiratory failure, with contested results
- Part of an approved injection for erectile dysfunction in some countries
In practice Off-label
- Used nasally in the mold-illness and CIRS community, following the Shoemaker protocol
- Typically a late step after other protocol stages
Science hasn't caught up: A defined patient community uses this on a specific protocol that mainstream medicine does not recognise.
Reported real-world use, not evidence and not a recommendation.
Worth knowing: Its one-minute half-life in blood makes practical use difficult. COVID-era aviptadil trials were widely criticised.
Status: Synthetic VIP (aviptadil) has been trialed for lung conditions and is approved in some countries in a combination product for erectile dysfunction.
- Route
- Intranasal spray, following the protocols it is used under
- Sequence
- HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
- Formula
- C147H238N44O42S
- Molecular weight
- 3325.8 g/mol
- CAS
- 40077-57-4
- Available as
- 2 mg, 10 mg
Educational information only. Nothing here is medical advice, a dosing protocol, or a recommendation to use any compound. Most entries describe substances not approved for human use. Talk to a licensed clinician before acting on anything you read here. How to read these entries.